PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00004.1.g07490.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 369aa    MW: 37360.3 Da    PI: 8.1371
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00004.1.g07490.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.34e-3975136263
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                                     kekal+cprC stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Zjn_sc00004.1.g07490.1.sm.mkhc  75 KEKALNCPRCSSTNTKFCYYNNYSLHQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 136
                                     7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3071133IPR003851Zinc finger, Dof-type
PfamPF027013.6E-3377133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.88279133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MDAAPWHQGL GLVKPMEDML MAANAPAGNP SQGSNPNPSA TAPAPSLTPG GALRGGAPAA  60
VPGAGSAERR VRPQKEKALN CPRCSSTNTK FCYYNNYSLH QPRYFCKTCR RYWTEGGSLR  120
NVPVGGGSRK NKRSSSSSAS TSASASVTSS SMASSMGVAS KNPKLTHEGA QDLNLAFPSG  180
LQAPGDFAAF PSLESGNMCN PGGAMTSNGR GVGTGSAVGA LSAMELLRST GGYMPLQVPM  240
QMPGDYAAAG FSFGEFRAPP PPSQSVLGFS LDAHGSAAGT AAAGYGSGAR LQGAPENASR  300
LLFPFEDLKI PVTSGDGEGD AGASGDTGDG NNGHHQFEHG KEQTAGGPGA GHDTPGFWNG  360
MIGGSGTSW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150043.11e-140dof zinc finger protein
RefseqXP_004976523.11e-140PREDICTED: dof zinc finger protein DOF4.6-like isoform X2
TrEMBLA0A0A9GUS71e-157A0A0A9GUS7_ARUDO; Uncharacterized protein
STRINGMLOC_68844.21e-131(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.16e-46Dof family protein